SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000025029 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000025029
Domain Number 1 Region: 79-240
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-39
Family CRAL/TRIO domain 0.00000155
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000025029
Domain Number - Region: 13-71
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0029
Family CRAL/TRIO N-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000025029   Gene: ENSOANG00000019737   Transcript: ENSOANT00000028833
Sequence length 240
Comment pep:novel supercontig:OANA5:Contig20806:5540:17686:1 gene:ENSOANG00000019737 transcript:ENSOANT00000028833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGNGRDRKPSIRGRFQENLRDVLLSLHNPDDYFLLCWLRDEGTELQKSQDHSLNPILQH
IAFRKQKDLDNANGWQTSEVTQLYLSGMCGYNCEGCPVWYDNFGTLDPKGLLSTTKQELL
RWKTRACEFLIQECEKQSQQLGKKVETIVMIFDCEGLGLRHLRKPAVELYQDLLIMVEKN
FPEILKNIFIVRAPKLFPVTYNLIKPFVSEETHKKTLVLGGERKREPCKEVEPDILCSEF
Download sequence
Identical sequences F6PMD0
ENSOANP00000025029 ENSOANP00000025029 9258.ENSOANP00000025029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]