SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000025035 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000025035
Domain Number 1 Region: 141-261
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-17
Family DBL homology domain (DH-domain) 0.0000407
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000143
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000025035   Gene: ENSOANG00000019741   Transcript: ENSOANT00000028839
Sequence length 270
Comment pep:novel supercontig:OANA5:Contig13:2531874:2746004:-1 gene:ENSOANG00000019741 transcript:ENSOANT00000028839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRVLHTVRQCIRLTDLSLQNAQTDEFLCLKNIRTFLSACCDTGLRKSELFEAFDLFDVRD
FGKVIETLSRLSRTPIALASGIRPFPTEESVNDEDIYKGLPIDETRAEDDEDLYDCVYGE
DEGGEVYDLMKAGEVHQLCNDIRSCCLTEIKQTEEKYTETLESIERYFMAPLKRFLSASE
FDSVFNIPELVKVHRSLMQEIHDSIVNKNVQNLQVFINKERVIYGQYCSGVESAITGLDY
ISKTKEDVKLKLEVCSSSKQEDGFLEDLLI
Download sequence
Identical sequences F7CH03
ENSOANP00000025035 9258.ENSOANP00000025035 ENSOANP00000025035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]