SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000025380 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000025380
Domain Number - Region: 36-91
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0711
Family Calponin-homology domain, CH-domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000025380   Gene: ENSOANG00000019995   Transcript: ENSOANT00000029184
Sequence length 103
Comment pep:novel supercontig:OANA5:Contig18030:1025:10619:-1 gene:ENSOANG00000019995 transcript:ENSOANT00000029184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKRGILQSRQIQEEITGNTEYVNSSGAKRDAFDTLFDHAPDKLNVVKKTLITFNKHLKLN
LEVTELETQFDGVYLVLIMGLLEGYFVPLHSFFLTPDSFEQKV
Download sequence
Identical sequences F6UYX4
9258.ENSOANP00000025380 ENSOANP00000025380 ENSOANP00000025380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]