SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000025942 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000025942
Domain Number 1 Region: 22-63
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000055
Family Calponin-homology domain, CH-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000025942   Gene: ENSOANG00000020406   Transcript: ENSOANT00000029745
Sequence length 91
Comment pep:novel supercontig:OANA5:Contig29082:2427:8315:1 gene:ENSOANG00000020406 transcript:ENSOANT00000029745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRALRRAAVWVSCCPPFSSPGSWVEQVTGKSFGDVDFRTALENGVLLCELLNAIKPGLVK
KTNRLAAPIAGLDERQWALKLSTATTLPAIR
Download sequence
Identical sequences F6XFV2
9258.ENSOANP00000025942 ENSOANP00000025942 ENSOANP00000025942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]