SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000026069 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000026069
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00241
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000026069   Gene: ENSOANG00000020499   Transcript: ENSOANT00000029872
Sequence length 195
Comment pep:novel supercontig:OANA5:Contig41422:24:4498:1 gene:ENSOANG00000020499 transcript:ENSOANT00000029872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLALCSVPDIVDGNLKSIMRLVLALAAHFKPGSGQGPARGPAPQPGYRPPCAAAVAQTAA
AALAEVCHDVSRSGREVFRFRQRSSSLDEEIENPCWSVRALVQQYEGQQGVPPEGSAPSL
TSSSPLHSAKSESASPQAEERASFVIVPCEAAENRAEEADAPFSRDWHVGRSGTWEEQLL
EQQDHLEKEMEEAKS
Download sequence
Identical sequences F7FQM1
ENSOANP00000026069 ENSOANP00000026069 9258.ENSOANP00000026069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]