SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000026766 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000026766
Domain Number 1 Region: 133-188
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000026766
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000778
Family SCAN domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000026766   Gene: ENSOANG00000021028   Transcript: ENSOANT00000030566
Sequence length 195
Comment pep:novel supercontig:OANA5:Contig10326:7136:11669:-1 gene:ENSOANG00000021028 transcript:ENSOANT00000030566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLPVSGPFLTVLPRGVQTWRLQQPASAEEVVTLVEDYRKRARGAAPPLTKPLSLSSPSL
QHHLDSLPLLFTPSPRPTAHMYIAQCPHPVTIDLIDSSFPLPPSAVPAPRGPTFPQGGNP
GDRAMAAAPEKARPQGLVTFEDVAVSFTWEEWEHLDSAQRNLFRDVMLENYGNLASLDEV
TQAQRSEVTCPQSPS
Download sequence
Identical sequences F7EIK1
ENSOANP00000026766 9258.ENSOANP00000026766 ENSOANP00000026766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]