SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027106 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000027106
Domain Number 1 Region: 312-417
Classification Level Classification E-value
Superfamily Spectrin repeat 4.54e-16
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 110-190
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000105
Family Spectrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027106   Gene: ENSOANG00000007739   Transcript: ENSOANT00000030906
Sequence length 421
Comment pep:novel supercontig:OANA5:Contig33612:345:4879:-1 gene:ENSOANG00000007739 transcript:ENSOANT00000030906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTMESQVEEWYREVGELQAQTAALPLEPESEKPGSSRGHFVPALMGQSKGNIQSRRGHGL
TCPPTHPPATPRSVKLVYVGRGPSGVLRSSPLPPSNPQSLRREIHGHQARVEEVLERAGA
VASLRSPEAEGVRQGLDQLRSLWGTLRDEAERRQQSLDAAFQVEQYYFDMAEVEAWLSEQ
ELLLMSEEKGKVGKGRIKCLQLSSQQLCGIGTGSNPVYSYSPQCLVKCLAHRERLTDTAI
IIIAPCRAVRAKCLREYSAAELEETFPAHKELPVQRGARGGTRRASPAPTRTQVLQEKFT
EFASETGAAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLL
AASRDLHKFFSDASELKGQIEEKRQRLPRLTAPPEPRPNAASMQRALRAFEHDLQLLVSQ
V
Download sequence
Identical sequences F6TT34
9258.ENSOANP00000027106 ENSOANP00000027106 ENSOANP00000027106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]