SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027336 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000027336
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-23
Family Spectrin repeat 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027336   Gene: ENSOANG00000021468   Transcript: ENSOANT00000031136
Sequence length 97
Comment pep:novel supercontig:OANA5:Contig170202:3:757:-1 gene:ENSOANG00000021468 transcript:ENSOANT00000031136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDYEKTSDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEI
NFNTLQTKRLSNRPAFMPSEGKMVSDISTAWGGLEQA
Download sequence
Identical sequences F6SVF9
ENSOANP00000027336 9258.ENSOANP00000027336 ENSOANP00000027336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]