SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000027825 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000027825
Domain Number - Region: 39-114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000027825   Gene: ENSOANG00000021826   Transcript: ENSOANT00000031623
Sequence length 148
Comment pep:known_by_projection supercontig:OANA5:Contig6526:6682:19681:1 gene:ENSOANG00000021826 transcript:ENSOANT00000031623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSKTTDCGDSFRYRQLQLSAESKVAEFLHQSKLKSFENERVQLVQEETSRNLIQCQLECE
KYQKKLEVLTKEFYGLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEITMQSAEMEN
EVEAERVLFSYGYGANVPTTAKRRLKHR
Download sequence
Identical sequences F6ZQ95
ENSOANP00000027825 ENSOANP00000027825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]