SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028052 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028052
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-21
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028052   Gene: ENSOANG00000022000   Transcript: ENSOANT00000031850
Sequence length 129
Comment pep:known_by_projection supercontig:OANA5:Contig3687:2336:7295:1 gene:ENSOANG00000022000 transcript:ENSOANT00000031850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEAMLKRAPDEVHNVREAIVQFINQKMQNLGLSVSDLETQFADGVILLLLIGQLEGFFLN
LKDFFLKPRNSEEMMHNVTLALELMKELGLLDFPIQPTGVVSGDTNTTLRVLYCLFAKHR
LSLGKDGRP
Download sequence
Identical sequences F7F5P0
9258.ENSOANP00000028052 ENSOANP00000028052 ENSOANP00000028052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]