SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028422 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028422
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-16
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028422   Gene: ENSOANG00000022278   Transcript: ENSOANT00000032219
Sequence length 82
Comment pep:known_by_projection supercontig:OANA5:Contig43468:2726:4123:1 gene:ENSOANG00000022278 transcript:ENSOANT00000032219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAELLRAGFQGLVTFKDVTMSISQEEWEQLDPDQVDFYGEYVPQENCDFVVSLGFSIPK
PQIFSHEDVGEGFWLPDLQPSE
Download sequence
Identical sequences F7AAL0
ENSOANP00000028422 ENSOANP00000028422 9258.ENSOANP00000028422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]