SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028450 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028450
Domain Number 1 Region: 36-184
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.76e-43
Family CRAL/TRIO domain 0.0000000835
Further Details:      
 
Domain Number 2 Region: 3-32
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000102
Family CRAL/TRIO N-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028450   Gene: ENSOANG00000022298   Transcript: ENSOANT00000032247
Sequence length 186
Comment pep:novel supercontig:OANA5:Contig10860:9505:13884:1 gene:ENSOANG00000022298 transcript:ENSOANT00000032247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAARNFDLPKSEAMLRKHVEFRKQRDIDNITSWQPPEVIQQYLSGGMCGYDNEGCPVWYD
IIGPLDARGLLLSASKQDLLRTKMRDCELMLQECKRQTEKVGKKVETITMIYDCEGLGLK
HLWKPAVEAYGEFLCMFEENYPETLRRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLG
ENWNQK
Download sequence
Identical sequences F6YS78
9258.ENSOANP00000028450 ENSOANP00000028450 ENSOANP00000028450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]