SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028474 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028474
Domain Number 1 Region: 28-119
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.89e-38
Family SCAN domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 831-888
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 875-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 794-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 925-960
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000137
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 216-276
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000183
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028474   Gene: ENSOANG00000022313   Transcript: ENSOANT00000032271
Sequence length 977
Comment pep:novel ultracontig:OANA5:Ultra521:6334:19267:1 gene:ENSOANG00000022313 transcript:ENSOANT00000032271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVLGSQLQASVEKDWGPKPAPRGESTDSETLRRRFRRFRYEEVAGPHEAFSKLWELCC
RWLRPEMRTKEQILELLVLEQFLTILPGDLRIWVQDQRPKSGEEAVGLVEDLQREPGRPG
QQVTVNVPKQKVLSDGPTEGAQEVLNHQMKQEESQPKEEFQKEGRWSPHPGPQEPASYKG
KPQLLQETAWPVPSGSVLPEEGSRRGQMATVLLVTGSQEPVPCEDTTGSPTRAELRHLAP
AQKALCRVIVQENHGNVIPMGFPIPNPNVISVLERRENTRIPKLQGSEEKRVSRGSPTGE
ERVRPERAPARREGQIWGDPRPRTLEDEKVAGVHWSFEETKTFLAILSESRFYEKLRTCQ
RNSQVYGAVAERLRERGFLRTLEQCRTKFKSLQASYWKERRGRLPEPCAFYEEMEALVNS
RASVSSVAILGETVSPPRLAEDGADTEERQQGPGMYEEVVEDDATEDSESDEMSPEEQSQ
EPRSPSTAIQFPSRMGTLEVTQGSDKPTIMSLAPRQLHYCNAGVHWGYEETKTFLAILSE
SRFYEKLRTCQRNSQVYGAVAEQLRDRGFLRSPEQCRTKFKSLQTSYRKVRRGHVPEPCA
FYKEMDILLSSWASVTRTDVFGKMASVSKQGRDEAETGAWTPRAAVEVSLAEDSDGVELG
LKELVPKVESSDSPVLFQTPSDFDVRSENKGKNPKWESSEDVGLPRTMSGRSDGELHPSS
NLKGECEHECRSRRQCGNVPGERQRKLTFQERDSKKGGAQQRLSIAAKSYKRLRGGKSFF
QNTHLLPRPSHDKVPKCRECGKSFSRGSYLVRHQRIHTGEKPHKCQECGKSFSERSNLTA
HLRTHTGERPYKCGECGKSFNQSSSLIVHQRTHTGEKPYKCGECGKRFNNSSQFSAHRRA
HTGESPYQCGECGKSFNNSSHFNAHQRIHTGEKPYECPQCGKSFTKSSALTRHQGVHMRE
KLLSQSRLNYTTDSRVL
Download sequence
Identical sequences F6YR66
ENSOANP00000028474 XP_007669825.1.37387 ENSOANP00000028474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]