SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028725 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000028725
Domain Number - Region: 138-179
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.00691
Family Outer membrane lipoprotein 0.0049
Further Details:      
 
Domain Number - Region: 45-180
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0142
Family Spectrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028725   Gene: ENSOANG00000022498   Transcript: ENSOANT00000032521
Sequence length 220
Comment pep:novel supercontig:OANA5:Contig17614:3162:11527:-1 gene:ENSOANG00000022498 transcript:ENSOANT00000032521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFICNPFKVLSLQIEKLTLESNEKRKALDSELTETLTAQIELDKTAEAFRRVHGERQELI
KQWENTIEQMQKRDQEIDRCALLATVKQEIRAKEGVIKEKIQFLESETGNNAEYEKKISF
ARQASKLRMEYQNQESSRNQLQNELESLKATVDRTSSDLESLRMEVANLKKEIKEKTHRL
SFTEQNQQTAKLNNVTEISLSLEEKASKMEDILKDEKNVK
Download sequence
Identical sequences F6TA91
ENSOANP00000028725 ENSOANP00000028725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]