SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028784 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028784
Domain Number 1 Region: 546-705
Classification Level Classification E-value
Superfamily Spectrin repeat 4.78e-29
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 766-923
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-28
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 374-488
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 128-268
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 218-365
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-23
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 6 Region: 917-1033
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-22
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 1280-1359
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.16e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 8 Region: 1191-1271
Classification Level Classification E-value
Superfamily EF-hand 2.63e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 9 Region: 44-167
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000095
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 1043-1115,1145-1175
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000398
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000028784
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0784
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028784   Gene: ENSOANG00000022542   Transcript: ENSOANT00000032580
Sequence length 1612
Comment pep:known ultracontig:OANA5:Ultra546:1421482:1482083:-1 gene:ENSOANG00000022542 transcript:ENSOANT00000032580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKTGPQLLELSPSEGFLIQEKYVAADTLYSQIKEDVKKRAVALDDAISQSTQFHDKIDQ
TLESLNRIVERLRQPPSISAEVEKIKEQISENKNVLVDLEKLQPVYETLKQRGEEMIARS
GGTNKDISAKAVQDKLDQMVLAWEDIQNLAEEREAKLLDVMELAEKFWCDHMSLVVTTKD
TQDFIRELESPGVDPSVVKQQQEAAEAIREEIDGLQEELDIVINLGSELITACGEPDKPI
VNKSIDELNSAWDSLNKTWKERIDKLEEAMQAAVQYQDGLQAIFDWVDIAGGKLSSMSPI
GTDLETVKQQIEELKQFKAEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKL
IWDSLDEKIVNRQHKLEGALLALGQFQHALDELLTWLTHTEDLLNEQKPVGGDPKAIEIE
LAKHHVLQNDVLAHQSTVEAVKKAGTDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQ
RKQQLDTALLQAQGFHGEIEDLHQWLTDTERHLLASKPVGGLPETAREQLNSHLELCAAF
EVKEEIYKRLMEKGQQMLARCPESAETNVDQDINNLKEKWESVQTKLSERKTKLEEALNL
AMEFHNSLQDFINWLTQAEQTLTIASRPSLILDTVLFQIDEHKVFATEVNSHRDQVIELD
KTGTHLKYFSQKQDVVLIKNLLISVQNRWEKVVQRLVERGRALDDARKRAKQFHEAWNKL
MEWLEESEKSLDSELEIANDPDKIKAQLTQHKEFQKSLGAKHSVYDTTNRTGRSLKEKAS
LTDDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYKIEPQ
LAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELVEGSRDDSSWVKVQM
QELSTRWETVCALSVSKQTRLEEALHQAEEFHSVVHVLLEWLAEAEQTLRFHGLLPDDEE
ALRTLIDQHKEFMKKLEEKRAELNKATGMGEAVLAICHPDSITTIKHWITIIRARFEEVL
AWAKQHQQRLAGALAGLIAKQELLEALLTWLQWAETTLSDKDKETIPQEIEEVKALIAEH
QTFMEEMTRKQPDVDKVTKTYKRKAADPSPIQSHIPVLDKGRTGRKRSPSSAVYPSGSQT
QIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELKEFANFDFDIWRKKYMRWMN
HKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYY
EFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDS
QQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIA
KGRTNMELREKFILADGASQTMAAFRPRGRRSRPSSRGASPNRSTSVSSQAGPVIPSQTI
VTSTPKTSHHLTRNYGKPWLTNSKTSTPSKPSESPDYQVSSAEGTPIQGSKLRLPGYLSG
KGFHSGEDSGLITTAASRVRMQFAESKRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISE
IQSVCSDMSETLPQANRPAPRAGPRPATAKPSKIPTPQRRSPATKLDKSSKR
Download sequence
Identical sequences F6RI60
ENSOANP00000028784 ENSOANP00000006815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]