SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029421 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029421
Domain Number 1 Region: 327-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 24-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000157
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 203-226,258-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000152
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029421   Gene: ENSOANG00000031976   Transcript: ENSOANT00000038665
Sequence length 394
Comment pep:known_by_projection supercontig:OANA5:Contig1664:62428:64659:-1 gene:ENSOANG00000031976 transcript:ENSOANT00000038665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLLRNRNFWVLRLPPATKGEGPKGPVAIENDGAYFSEQEWENLEEWQKELYRNVMKSN
YETLVSLDCALPTLELLPPQARGEDPVVPEELGHLEERESLAGPRLVDGIAIKQEEPCGA
EDPEGPVPPEPAGECSGDPGEPGAGWEDPAGPDPVAGAEPEEPPARPGGGTPPRPRKRPA
GGRAGQGLRPKRGPRSPPPAAGPYECSECEISFRYKQQLAGHRQAHPGWDPAEAPEEEEE
EEEGGGGRPRPRLEPPAKRARPHRCDQCLKSFSCKASLATHQRSHPRQGPGQGPGLGPPR
APERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYRCPDCG
KGFVQKQHLLQHQKIHLRERGGPQREPGGAHPLL
Download sequence
Identical sequences K7E7B4
ENSOANP00000029421 ENSOANP00000029421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]