SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029615 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029615
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.38e-16
Family Calponin-homology domain, CH-domain 0.0000549
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000029615
Domain Number - Region: 73-113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000259
Family Spectrin repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029615   Gene: ENSOANG00000030658   Transcript: ENSOANT00000038859
Sequence length 121
Comment pep:novel supercontig:OANA5:Contig51598:4256:4956:-1 gene:ENSOANG00000030658 transcript:ENSOANT00000038859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIDMNKVYHQSNLENLDQAFGVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAM
PRVPDAQDGVRANELQLRWQEYRELVMLLLQWVRHHIVSFEERKFPTSFEEIEVSGFPRR
L
Download sequence
Identical sequences K7E7V8
ENSOANP00000029615 ENSOANP00000029615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]