SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029617 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029617
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-24
Family Spectrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029617   Gene: ENSOANG00000029026   Transcript: ENSOANT00000038861
Sequence length 113
Comment pep:novel supercontig:OANA5:Contig8248:12438:15711:1 gene:ENSOANG00000029026 transcript:ENSOANT00000038861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFQDADDTKERIKKNRRALSVADLGSDLFSVQALQRRHEGFKRDLTPLGEKVTALGETA
ERLTESHPDAADELRGRRLELSDAWDDLLQHTDQRKEDLAQAQKLFLFLNQAR
Download sequence
Identical sequences K7E7W0
ENSOANP00000029617 ENSOANP00000029617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]