SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030018 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030018
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-18
Family Spectrin repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030018   Gene: ENSOANG00000029452   Transcript: ENSOANT00000039263
Sequence length 91
Comment pep:novel supercontig:OANA5:Contig8248:25298:27557:1 gene:ENSOANG00000029452 transcript:ENSOANT00000039263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYARDLASAGNLLKKHQLLQTEMSARGDILEELNQLAANLVDTGAFNADQIVAKRESV
NERFAEVQKQAIAHHQKLKEAYALFQFFHDL
Download sequence
Identical sequences K7E911
ENSOANP00000030018 ENSOANP00000030018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]