SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030065 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030065
Domain Number 1 Region: 81-229
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-21
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030065   Gene: ENSOANG00000028384   Transcript: ENSOANT00000039309
Sequence length 232
Comment pep:novel supercontig:OANA5:Contig10469:3348:5295:1 gene:ENSOANG00000028384 transcript:ENSOANT00000039309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWSRPSSRRHRPAAPRAPSRGWGRGGESGPLPPQLLEAESWLSERGFLLDGEETGQSEEA
TQALLRRLEVTRRDLEGFAARIEKLQETGTGLERRHNPESPQVLPRLRTVRETHGELLQR
AESRGRRLREQQRFFLLEREARLLEAWLAAKQAVAESQDYGQDLEDVKELEEKFDAFRKE
VQVLGQAKMQGLRDLAADLDQEAPGRYQEVQGHRRRVEESWERLGQAMKAPH
Download sequence
Identical sequences K7E958
ENSOANP00000030065 ENSOANP00000030065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]