SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030120 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030120
Domain Number 1 Region: 16-83
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000115
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030120   Gene: ENSOANG00000029852   Transcript: ENSOANT00000039364
Sequence length 103
Comment pep:novel supercontig:OANA5:Contig41353:4209:5608:-1 gene:ENSOANG00000029852 transcript:ENSOANT00000039364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASYLATGPVDLPLSLQFHRDVKDAQELLRKVDGDLDQKYSPDFKDSFQIESLLRDLDDQ
EKALDKYEDVVRALQKRGQQVAPLKFRRETPLKPIPVEALCDF
Download sequence
Identical sequences K7E9B3
ENSOANP00000030120 ENSOANP00000030120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]