SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030432 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000030432
Domain Number - Region: 12-128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030432   Gene: ENSOANG00000028667   Transcript: ENSOANT00000039670
Sequence length 329
Comment pep:novel ultracontig:OANA5:Ultra544:2836491:2856367:-1 gene:ENSOANG00000028667 transcript:ENSOANT00000039670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNSETPGEKKSEQWRTLEEALKDRRKAVDEAADALLKAKEELEKTKGVIENTKKTQMAG
AKPPVTAAEENLHHMIVDLDNVVKKVQAAQSEAKVVAQYHELVAKARDEFQRELDSITPD
LHPGWKGLKISDLAGQLSTDDLNSLIVHAHRRVDQLNRELAQQKVREQQHIEAALQQQKL
EDKRAFESAVAKALDRHRDEIQMEQDRKVEEVKDVMEVEMRTQLRRQAAAHTDHLRDVLR
IQEQELKQQYEQGLSEKLSEQEMEFRRLNQEQVDNFTLDINTAYARLRGIEQAVHSEYLQ
SINRWCRLSTYCVQSAVASAREEYSTRVG
Download sequence
Identical sequences K7EA75
ENSOANP00000030432 ENSOANP00000030432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]