SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030724 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030724
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000222
Family Spectrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030724   Gene: ENSOANG00000029645   Transcript: ENSOANT00000039963
Sequence length 63
Comment pep:novel supercontig:OANA5:Contig8248:9665:11772:1 gene:ENSOANG00000029645 transcript:ENSOANT00000039963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDWIRDKKAENTVIDLDNVQELQKKFDDFQTDLKSNEPRLQDINKVADDLMIENLLTPE
GAE
Download sequence
Identical sequences K7EB17
ENSOANP00000030724 ENSOANP00000030724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]