SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030813 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000030813
Domain Number - Region: 48-86
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.017
Family GAS2 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030813   Gene: ENSOANG00000031593   Transcript: ENSOANT00000040052
Sequence length 116
Comment pep:known_by_projection supercontig:OANA5:Contig16582:3390:9394:-1 gene:ENSOANG00000031593 transcript:ENSOANT00000040052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KILFLVFFFPVPFWLVSLRQSEATSLTRFLVSWKQLPLRGFRSDARNFHTAPARAFLRLR
PFHFLVATGGGYAGYRQYVKYRDHQLEKLGIEIPPQIAGEWEVGCLMGFIHLLSKS
Download sequence
Identical sequences K7EBA6
ENSOANP00000030813 ENSOANP00000030813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]