SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030978 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030978
Domain Number 1 Region: 3-48
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000366
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030978   Gene: ENSOANG00000031690   Transcript: ENSOANT00000040216
Sequence length 173
Comment pep:novel supercontig:OANA5:Contig29533:11845:12565:1 gene:ENSOANG00000031690 transcript:ENSOANT00000040216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEGEPGTPWRGATR
GEERRTRNRDQAGDGSPGSFRRREPDPPRVPLLGRPSSGLRNRPMPGVRVRPGAPDAASR
QPRELRRPPGSLGHPLLWASPLAGRNFSVSLTSVLPAASGAQVFPSPPRVGQQ
Download sequence
Identical sequences K7EBS1
ENSOANP00000030978 ENSOANP00000030978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]