SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000030993 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000030993
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-30
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 164-198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000848
Family Spectrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000030993   Gene: ENSOANG00000030713   Transcript: ENSOANT00000040231
Sequence length 205
Comment pep:novel supercontig:OANA5:Contig8248:16512:23225:1 gene:ENSOANG00000030713 transcript:ENSOANT00000040231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQEPAFKALEDYGAELVGQDHPGREEIREKLEQVKQERKDLQEAWNQRKHMLDQCLDL
QLFRGDCEQASSWMSAREGTLGTDEAGPLDRLEVLMKKRDALDKAIHSQEEKMEALERFA
GRLIEDDHYAKEDISAWLQKLLERWIALKDRMLEERAKLGDFADLKQFYRDIEEIEDWIN
EKLPIACDESYKDPANIQVGGWKRS
Download sequence
Identical sequences K7EBT6
ENSOANP00000030993 ENSOANP00000030993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]