SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031009 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031009
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.18e-22
Family GAS2 domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031009   Gene: ENSOANG00000030299   Transcript: ENSOANT00000040247
Sequence length 68
Comment pep:novel supercontig:OANA5:Contig7630:46985:47959:-1 gene:ENSOANG00000030299 transcript:ENSOANT00000040247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKVSEGKYKVGDSSALIFVRVLRRHVMVRVGGGWDTLEHYLDNHDPCRCTSLCEYLGQL
RWSWGSWG
Download sequence
Identical sequences K7EBV2
ENSOANP00000031009 ENSOANP00000031009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]