SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031178 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031178
Domain Number 1 Region: 732-824
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000036
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000112
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 131-240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000031178
Domain Number - Region: 771-924
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00993
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031178   Gene: ENSOANG00000028997   Transcript: ENSOANT00000040420
Sequence length 1260
Comment pep:novel supercontig:OANA5:Contig283:844945:861846:1 gene:ENSOANG00000028997 transcript:ENSOANT00000040420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQETILDLENQWDRTIHLANKYLSHQEKLRLEGDKYLQSKEDLKLMLTELKKQQEAGFA
LQHGLQEKKAQLKKFKKFLQKAEDLTSLLNELKAQGNYLLECTKNHNFSEEPWLEIKHLH
ESLLLQLQESVKKSEGHVQEHQLYQDLITDLRTTLKRFSEGLCRITDVPIDKMAAENTVL
KIQEQEEALCQKGITLEKILSLAQSVKQNTSSVGKKMITDETESLKVRYRELESRLQFVK
QEAADRLNDILQSKSELPSRDKEATALHEQKPVGPAVCASVPGASGVGKLTPDWVVSKDL
EADILTEQQSLVHMGSKSNTLEKDSTEMFNSEDLLEVQEQLNILLGDCDLYKSQLKLSAP
NLVGDQTESVSKVAQDLPKRDQLPCTNVEEIVPVLDEEQNLSLEMISLEQLFPDAEASME
SIEDEQKVTKLQNQAFELNTLCAKEQLKELEKLYTKLKEKRAAILPLEQHVSSQYASASE
PWNAKYAASQMDKLLHTLSALKDDKHRQYILIKNFKKHLSAVKASIKALSAEKETLKTGT
QDRKLYQKKMERCLDSIQKEGDSLCRLKMEQENVSGYLTEMDKKFSESQVRHLEHCWEHV
EQVVQKKYSQLVAEDDEFKFLMNKARDIERLLQRLQRCAELGSTSPEGQEENEGLLSLAT
ELQVTKHRISLLKGRTEHELKRIWGEEEKETLENTINALQKQLEAMETPRPEVAGQTEKW
EIMTAGGEVVVWVKSSLASLDQGVTLLPEDVLSQARKHQTVHAEILGKWPAIEALVEEAG
VVAPRLSEQEAANMSFYLKELQDLYQLLVFKSTQRSQLLESKLEERERLFSEIKRIQSFL
QENEILILPDIRTTFTKDKLEHQYVTLKSSHEKLTKIKGVILTYLQENPFSQKDQNIFEQ
IFLCDQLRSLKNRADRTQRLIQNKYHDVRKMLNVYNELLEQATLFQQELIKVHCDELRLD
KEGILRTNQEVKDIFSVLKERLFVLQTHVSQVLKHKELFECVGLSWDTSQLSELQTQLLK
IESELEENFRKSDRLAAEHDQYQASLSEILVLTSQLKSETAALASQPESPPKHGFQAAQT
LDRRVEKTQFLTQAAENQLKTSEVFEESFKRKELKRIKSLSKDHKWMHRFLQDMALGFQP
KYINEKDFLSKLDDSFHELMQIKSQVQHPLLVDLDLKCIQDERNYYETLQEKVQVEVCII
NALTGEEKQKQEENSGEPNSWETKYKELENLQIQLMRDIASSLVSMCSRRLGHPFVKADY
Download sequence
Identical sequences K7ECC1
ENSOANP00000031178 ENSOANP00000031178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]