SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031288 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031288
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily L domain-like 7.37e-35
Family Ngr ectodomain-like 0.075
Further Details:      
 
Domain Number 2 Region: 553-669
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.63e-28
Family Calponin-homology domain, CH-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031288   Gene: ENSOANG00000014285   Transcript: ENSOANT00000040533
Sequence length 680
Comment pep:known_by_projection supercontig:OANA5:Contig1195:101372:181085:1 gene:ENSOANG00000014285 transcript:ENSOANT00000040533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEACHFVSLESLNLYQNCIRYIPEAILNLQALSFLNISRNQLSTLPVHMCNLPLKVLIAS
NNKLVSLPEEIGQLRHLTELDVSCNEIQTVPPQVGNLECLRDLNIRRNHLVRLPEELAEL
PLIRLDVSCNKITTIPVCYRKLRHLQMITLDNNPLQSPPAQICIKGKIHIFKYLNIEACK
SVPDLPDYDRRPMGFSSCHEELYSGRSYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLR
VAEVTKEQRLRRENQYQENRGSVVVTNGGGEHDLDQIDYIDSCATEEEEDEVRQPKRVDS
DSLSSEFMAYIEQRSISHEVGSPVKPMPIRECQRTEDIRKCSHQNRVPVEASYLLSLSQN
HNQLSHTDPEPTRGREQLVERTRREAQLAALQYEEEKMRTKQIQREALLGFVKQKAMQSP
QKQSPLDSECPFPSRRSQHTDDSALLVSLSGLNQEGCATTLLHASAFRPVKSDDRPGISP
TSPVAQTGSVHLSSPYSGPAASNCRNPSQRPESFLFRAAIRDEAHKGCTSPLLSSSALPT
DSMDPQARHDPSQQDEDLESINQLRKNIEFRLKVSLPSDLGAALTDGVVLCHLANHVRPR
SVSSIHVPSPAVPKLTMAKCRRNVENFLDACRKIGVPQEQLCLPRHILEEKGLGQVSVTV
QALLELAPPKQPPQHHSSAV
Download sequence
Identical sequences K7ECN1
ENSOANP00000031288 9258.ENSOANP00000022514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]