SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031344 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031344
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.93e-26
Family CRAL/TRIO domain 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031344   Gene: ENSOANG00000030419   Transcript: ENSOANT00000040590
Sequence length 159
Comment pep:novel supercontig:OANA5:Contig62377:21:1732:-1 gene:ENSOANG00000030419 transcript:ENSOANT00000040590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGYDNEGCPVWYDIIGPLDARGLLLSASKQDMLRTKMRDCELMLQECKRQTEKVGKKVE
TITMIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLRRLFVVKGELGSGAGKSAKTE
RGRHCQSTEKRDEGYPWHRVGGRPINPSDRNRAGAALPV
Download sequence
Identical sequences K7ECT7
ENSOANP00000031344 ENSOANP00000031344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]