SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031395 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031395
Domain Number 1 Region: 48-160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000023
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031395   Gene: ENSOANG00000028329   Transcript: ENSOANT00000040642
Sequence length 197
Comment pep:novel supercontig:OANA5:Contig283:830864:836102:1 gene:ENSOANG00000028329 transcript:ENSOANT00000040642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEALPQLKTDKGEMPNQLCRATECFWDNVKSSVVECLEQCERIMELLKQYQSCKSVLTT
LIQKKESIVSQQASYMGKENLQRRIATIEMVREEFNEHSQDVDRINQICKNLQYQLNKMK
TYEEPPFEKEANIIVDRWLDVNEKTENYYENLGRALALWEKLLNLSSVIDEWTQKELVHV
EVHGCPEEEVARLKVMN
Download sequence
Identical sequences K7ECY8
ENSOANP00000031395 ENSOANP00000031395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]