SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031535 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031535
Domain Number 1 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031535   Gene: ENSOANG00000031247   Transcript: ENSOANT00000040781
Sequence length 248
Comment pep:novel supercontig:OANA5:Contig14358:10545:17104:-1 gene:ENSOANG00000031247 transcript:ENSOANT00000040781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDWDGPEAPLAPRAGNRRKPPSMEEKGRGEPAFQRDDGKKAEGPESRLATSAASDPWSG
REKGDVAGFAADVFPALGDGPAASEPPAGSAGGEEADEAREEEEREQREEDGEREGSGPS
PGEALQAVRLLRKFYQALETEPRILVLLRFLEGDIENVHLAHPRKQVPVTFEDVAVYFSR
EEWAALDGRQKELYRDVMRGNYELVASLDGLSPKPDLETQIKSEEEPGVGDGGHPAPKGV
PTSALPGE
Download sequence
Identical sequences K7EDC8
XP_007655711.1.37387 XP_007655712.1.37387 XP_007655713.1.37387 XP_007655714.1.37387 XP_007655715.1.37387 XP_016081112.1.37387 ENSOANP00000031535 ENSOANP00000031535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]