SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031574 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031574
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.01e-16
Family CRAL/TRIO domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031574   Gene: ENSOANG00000029337   Transcript: ENSOANT00000040820
Sequence length 61
Comment pep:known_by_projection supercontig:OANA5:Contig2781:43425:47346:-1 gene:ENSOANG00000029337 transcript:ENSOANT00000040820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAAGIRPSELRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYSVVKPFLKNKLLERVRQ
G
Download sequence
Identical sequences K7EDG7
ENSOANP00000031574 ENSOANP00000031574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]