SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032268 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032268
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-34
Family Calponin-homology domain, CH-domain 0.0000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032268   Gene: ENSOANG00000031030   Transcript: ENSOANT00000041516
Sequence length 124
Comment pep:novel supercontig:OANA5:Contig32225:69:562:1 gene:ENSOANG00000031030 transcript:ENSOANT00000041516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLYLQENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIELSR
NEALIALLNEGEELEQLMKLSPEELLLRWVNYHLANAGWQKISNFSQDIKVSFHAPASSA
TQRV
Download sequence
Identical sequences K7EFG1
ENSOANP00000032268 ENSOANP00000032268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]