SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032330 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032330
Domain Number 1 Region: 96-211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000072
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000032330
Domain Number - Region: 219-291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000648
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 14-87
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032330   Gene: ENSOANG00000030260   Transcript: ENSOANT00000041578
Sequence length 295
Comment pep:novel supercontig:OANA5:Contig283:839312:842708:1 gene:ENSOANG00000030260 transcript:ENSOANT00000041578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLENQIGCLTPELAELKKQYESVSDLFKTKKSILQDHFSNLLNDQCKSFNDWLSSTKV
SLVECFEPSETKKSMEDKLQKLTDFLTFEGRGSTMQQVETVLNQAKRHLPKANVSQLNGW
IVNQETELQRMDSLCQARIKELHDYLQQLVRLQEDSKSLNKWLTTQEEKWKETKESKKQP
EIFYRALKRQRDSFDALAQLTNSLEKSGLTSEETVTEGTRLVSRYQALLSRLSDQQGECE
LLSVVDQNFEDLAQETFSWITEIKESLIALNSTEGTMPLEERIQKIKVLQSVMTL
Download sequence
Identical sequences K7EFM3
ENSOANP00000032330 ENSOANP00000032330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]