SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032349 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000032349
Domain Number - Region: 35-82
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000959
Family Spectrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032349   Gene: ENSOANG00000030813   Transcript: ENSOANT00000041598
Sequence length 92
Comment pep:novel supercontig:OANA5:Contig10769:4637:14772:1 gene:ENSOANG00000030813 transcript:ENSOANT00000041598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DELKLAGKQGATLLSCIREPVTKSPSTKLNPDELENVATVERLLAQLDETEKAFDQFWSK
HYLKLDQCLQLRHFEHDFREVQCYFSFRSQTR
Download sequence
Identical sequences K7EFP2
ENSOANP00000032349 ENSOANP00000032349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]