SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032515 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032515
Domain Number 1 Region: 128-266
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-26
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 32-159
Classification Level Classification E-value
Superfamily Spectrin repeat 5.69e-20
Family Spectrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032515   Gene: ENSOANG00000030059   Transcript: ENSOANT00000041764
Sequence length 280
Comment pep:novel supercontig:OANA5:Contig10469:135:2158:1 gene:ENSOANG00000030059 transcript:ENSOANT00000041764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSLQPPAPLPVTGTDRGLPVQPLEQEVIRLGQRSPGSAHSLARKQREMADGWRNLQI
QLKLRREKLGAVHQLRKFQTELQAVLGWARGLRATVESAALPGSSAEAHSLLEEHREHKT
EMGTRGDSISSVRSTGRRLLGARHPSAPEVRQALDDLDRELVELEEAWQARQLRLTQARD
LQAFLSLAEQSESWLGSKEAFLASEDLEDSLARVENLQRKHEQFEKGLEAQSEMLDAMET
LAHSLRQAQHPEAQSATRKCQAVLARCLGPGGEGAHGEGA
Download sequence
Identical sequences K7EG58
ENSOANP00000032515 ENSOANP00000032515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]