SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032606 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032606
Domain Number 1 Region: 32-111
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-20
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032606   Gene: ENSOANG00000031239   Transcript: ENSOANT00000041854
Sequence length 118
Comment pep:novel chromosome:OANA5:3:9008053:9025764:-1 gene:ENSOANG00000031239 transcript:ENSOANT00000041854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFNFFLLFFFYIFSSAGFSPGASKETISTFDYQGPKRKLYSAVPGRLFVVVKPYQPQVDG
EIHLHRGDRVKVLSIGEGGFWEGSTRGHIGWFPADCVEEIQCKPNESKPGKGDTIHLL
Download sequence
Identical sequences K7EGE9
ENSOANP00000032606 ENSOANP00000032606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]