SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032777 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032777
Domain Number 1 Region: 64-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000327
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032777   Gene: ENSOANG00000030787   Transcript: ENSOANT00000042025
Sequence length 161
Comment pep:novel supercontig:OANA5:Contig9985:3751:14416:1 gene:ENSOANG00000030787 transcript:ENSOANT00000042025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIFISYFLFYFKVNDHLKDILEQEQKLKDHHTVETPGGQKSPSKWFWKLVPARYRKEQT
LLKQLPCIPLVENLLKDGTDGCALAALIHFYCPDIVRLEDICLKETMSLADSLYNLQLIQ
EFCQEYLNQCCHFTLEDMLYASSSIKVSNNRFSCSVALKTL
Download sequence
Identical sequences K7EGX0
ENSOANP00000032777 ENSOANP00000032777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]