SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032970 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032970
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000302
Family Spectrin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032970   Gene: ENSOANG00000030709   Transcript: ENSOANT00000042217
Sequence length 182
Comment pep:novel supercontig:OANA5:Contig20151:411:5062:-1 gene:ENSOANG00000030709 transcript:ENSOANT00000042217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPEQQDDETGLGQLADADQQTGTFDQWELIQAQDLQNKLRLKRNLKQWNRLNSELQVV
TAWLKKAEGELEEFQKSEPATSLQEIERQVKKLKDILKAFAGYKASLISVNLSSEEFQQG
ESSESKELHNRLRQLNLHWEKTSRAADSWREGLRRSLMECQVRRADGSPWPALRPALGAQ
GL
Download sequence
Identical sequences K7EHG3
ENSOANP00000032970 ENSOANP00000032970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]