SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033100 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033100
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-19
Family Calponin-homology domain, CH-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033100   Gene: ENSOANG00000028613   Transcript: ENSOANT00000042345
Sequence length 142
Comment pep:known_by_projection ultracontig:OANA5:Ultra627:15543:26256:1 gene:ENSOANG00000028613 transcript:ENSOANT00000042345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAINLPLNPIPFEVDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGER
IIVKDLAEDMYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINDTLKLPPR
SIKWNVDCEFIHSFIQSYLLSA
Download sequence
Identical sequences K7EHU3
ENSOANP00000033100 ENSOANP00000033100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]