SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033179 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033179
Domain Number 1 Region: 58-97
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000278
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033179   Gene: ENSOANG00000029125   Transcript: ENSOANT00000042425
Sequence length 111
Comment pep:novel supercontig:OANA5:Contig13:6217507:6219894:1 gene:ENSOANG00000029125 transcript:ENSOANT00000042425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFATISSLFSNPVPALPSALQVRHLYDTGELKDIHLEIENMVNSRTPKLTRNESVARSSK
LLGWCQRQTEGWAGVDVTDLTVSWKSGLALCAIIHXXXXXXXXXXXXXXXX
Download sequence
Identical sequences K7EI22
ENSOANP00000033179 ENSOANP00000033179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]