SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000033242 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000033242
Domain Number 1 Region: 9-92,122-149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000918
Family Spectrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000033242   Gene: ENSOANG00000031059   Transcript: ENSOANT00000042487
Sequence length 493
Comment pep:novel supercontig:OANA5:Contig30893:1924:8416:-1 gene:ENSOANG00000031059 transcript:ENSOANT00000042487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAPGRPSRSRSLQKAKDAYSSYRSGCDQVNQFLANVPSYEPQETDSVDQVETKLRNQKN
LLNEIGSREQEVQQVSAAAQQYRQAVKEYELEAEKLRSLLDLENRRNDPANKKPRIASPA
ARVKEEEAALSAKFTEVSAINRQRLQNLEFAQNLLKQQPEAAARPGPPGPPAEETWKVKK
ELDDATQRREQLEGEVRAAQSEVRALQNGAPPETVVRKEVLRRVPDPELSESFRQTQEAL
AEEKRQNRALRTELEALRLRLRGLEREAGEGGREYVVKEVLRIERDKAQVAEAARLREEL
EELRRQKGAREAEAALLQQRLAAAEQEVAAAAAERPAVTEKEVVKLQNDPELQAEYERLR
AAGRAEGARRQRQEEELGLLQDRLKRLERERAMAEGKTAVKEVLTVEKDVAAEREAGELK
RQYEEEAERARGRQREKTELLRQVRALEEESAQVRVQEKVREVVRLGPRGGGPGGRPAPX
XXXXXXXXXXXXX
Download sequence
Identical sequences K7EI85
ENSOANP00000033242 ENSOANP00000033242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]