SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000001673 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000001673
Domain Number 1 Region: 816-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000254
Family Laminin-type module 0.00048
Further Details:      
 
Domain Number 2 Region: 275-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 3 Region: 872-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 4 Region: 923-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 5 Region: 331-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 713-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 387-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 8 Region: 774-818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 9 Region: 434-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 971-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000001673
Domain Number - Region: 672-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000001673   Gene: ENSOANG00000001050   Transcript: ENSOANT00000001674
Sequence length 1329
Comment pep:known_by_projection chromosome:OANA5:4:20277496:20329403:-1 gene:ENSOANG00000001050 transcript:ENSOANT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPASTLCLGVLLGLGLPRAWGAMDACYDPRGHPQRCLPVFENAAFGREVEVTNTCGSPP
EDYCLQMGGPGDTQLCHRCDARDPDRHHNATYLTDFHSQEESTWWQSQSMAFGVQHPNSV
NITLRLATGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWVPYQFYSASCWKTYGQQER
QYLRPGEDERVAFCTPEFSDISPLSGGNVAFSTLEGRPSAYNFDESPVLQEWVTSTELLI
SLDRLNTFGDDIFKDPKVLQSYYYAISDFSVGGRCKCHGHASQCALDKEGRLVCLCQHNT
TGVDCERCQPFYQDRPWARGTAEAANECLPCNCSGHSEECFYDRELFRSTGHGGHCRNCR
AHTAGPHCERCQENFYRWDPQKPCQPCDCHPAGSLLLQCDNSGTCVCKPSVTGWKCDRCL
AGFHSLSEGGCRPCTCNPAGSLGPCDPHNGRCPCKENVEGHLCDSNRRGDIDIKARNQQG
KPLSVCMYIGPAAASQGGVASHSFIRVWGPGPEGWRAEDPRGRELLVQGDRSGIFPKPDP
GAPWDLIAPEKFLGDQRLSYGQPLSLTFQVPTGTALLPVRLWLEGAGLVLSVSRSGPMGG
QDPDRSEEHRVVFRLWEAEETEPSLSPFHFQRLLSNLTALRIRVGGGSTHLKGQGREERL
LRKREGVLGRVPGKWVENCACPQGYVGQFCESCSPGYKREIPSGGPYASCIPCTCNQHGS
CDPESGICQCQHHTEGPSCERCVAGFYGNPFGGHPDDCKPCPCPGPSMCMAIPESGEVVC
THCPQNQRGRRCELCDDGFFGDPLGRSGPPIPCRPCQCSGNVDPNAVGNCEPLSGRCLRC
LHNTSGPHCERCREGFYGSALSPAPGGNCTACSCNQVGSARDQGECDPVSGQCSCLPHVT
GRDCSSCSPGFYDLRAEKGCKSCECHPVGSKKKHCHPVTGQCPCLPGITGTACGQCRPGF
FGFSAKGCRACNCSPLGSITPQCHENGTCVCKPGFVGYKCERCQVNFFPSADGTQCLECP
LCFSLVKDEADKLKAKLKGLEQSLQRPECGSPWQHYLVQGDAPRGDSYHSPHLLQGARDA
FLEQMTALAASVKTSWSQLQTAKGNTSCARDSTEKTCTLLADIGAELQSAEREIRQAADL
LSTMVIPQDALNLPTNWSLLAAESRALAESHVDMAATIENVARRATIASNASFSLVRSLL
EGAAGLEALLDLQNRYQEVQRAQKEVGTAMAELAIQAKSTLTAVQRASANGTRGLSELST
HGELAPETSAEDLAKRAQELGQTMASKEHLVTEATQDLLSSSREELQKIRPFVQVRPDPP
ALGKGSLAA
Download sequence
Identical sequences F6PIC4
ENSOANP00000001673 ENSOANP00000001673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]