SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000004155 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000004155
Domain Number 1 Region: 570-869
Classification Level Classification E-value
Superfamily L domain-like 2.95e-47
Family Ngr ectodomain-like 0.052
Further Details:      
 
Domain Number 2 Region: 117-507
Classification Level Classification E-value
Superfamily L domain-like 1.77e-40
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 957-1112
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.29e-37
Family Toll/Interleukin receptor TIR domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000004155   Gene: ENSOANG00000002612   Transcript: ENSOANT00000004156
Sequence length 1124
Comment pep:known_by_projection ultracontig:OANA5:Ultra462:7060198:7071182:1 gene:ENSOANG00000002612 transcript:ENSOANT00000004156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMLTGLQRCQRDTGRKNRNLCTSANPMPMRGSFGRTVVFLLTPALPPPEGRSASDRRPQ
HHAQTMQPLKEFPRWTLSQWYFVLFQLFLLSKLPGAVWFPKSLPCDVTTDAPAAAPETAV
VVNCTERHLTEIPQGIPANTTNLTLTINHIPNIGPASFAGLVNLVEIDFRCNCIPVRLGA
KDHMCIKSLEIEDGSFARLTRLKSLYLDGNQLPEIPRGLPPNLRLLSLEANSIFSILKEN
LTELANIEILYLGQNCYYRNPCNVSFFIDAAAFEDMRSLTVLSLKANNLSAVPAGLPSSL
KELYLYNNIIQVVNKADFQDLKQLQILDLSGNCPRCYNVPFLCTPCPNDSSIRIDANAFD
SLTQLKILRLHSNSLYRVPKSWFKNMKNLEALDLSQNFLAKEMGEARFLRFLPNLVELDL
SFNFELRVYSAFLNLSKEFSSLRKLKVLRIRGYVFQELKTDHLSPLLSLPHLEVLDLGTN
FIKVADLSVFKKFRALRSLDLSVNKISPSSGESRENGFCSLPKASANQHSHQLLREIHYF
MYDEFGRSCKFKNKEDHSFPPANEACQNYGESLDLSKNNIFFVNPTDFQHLSFLKCLNLS
GNAISQTLNGSEFQPLTELRYLDFSNNRLDLLYSTAFQELQKLEVLDLSSNSHYFLSEGL
THMLNFTKNLLYLKKLIMNGNEISTSTSMVMESESLVALEFRGNHLNVLWRDGDSRYLKF
FKNLTHLEQLDISENFLSFLPPGVFEGMPPNLKDLNLANNGLKKFNWGNLHFLRNLETLD
LSYNLLTTTPRELSNCSRSLRKLILRNNQIKHLTTHFLRGSLKLRYLDLSYNKIKIIQQS
SFPENIINNLEMLLLHHNPFLCTCDAVWFVWWINRTQVTIPYLATEVICAGPGAHRGQSI
VLLDLYTCGLDSIDVILYYVSVSITLCLMITAVMNHLYFWDVWYSYHFFTAKLRGYRRLI
TPDTCYDAFVVYDTKDPATAEWVLSELVANLEDQRDKQFNLCLEERDWLPGQPVLDNLSQ
SIQLSKKTVFVMTNTFMKSENFKTAFYLAHQRLIDEKVDVIILIFLERVLQNSRYLQLRK
RLCGRSVLEWPANPQAQPYFWQCLRSALATDNKAAYGKLFREIV
Download sequence
Identical sequences F7E123
ENSOANP00000004155 ENSOANP00000004155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]