SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000004859 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000004859
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Macro domain-like 9.03e-32
Family Macro domain 0.0007
Further Details:      
 
Domain Number 2 Region: 226-326
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000379
Family CRAL/TRIO domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000004859   Gene: ENSOANG00000003069   Transcript: ENSOANT00000004860
Sequence length 331
Comment pep:known_by_projection ultracontig:OANA5:Ultra182:139469:149484:-1 gene:ENSOANG00000003069 transcript:ENSOANT00000004860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYWNVLQLTKEQAMSSVG
FCVINSAKRGYPLEDATHIALRTVRRFLEAHGDTIEKVVFAVSDLEEATYRKLLPLYFPR
SLEEEARSLPLLPADIGNAQGEPVVPERQIRISEKPGAPEAEEDEEEDGLEVGLSFVGSH
AFARMEEDVDKQRRLVLQGQLSEEAALQKQHQRNYNRWLCQARAEDLSDIASLKALYQTG
VDNCGRTVMVVVGRNIPVTLIDMDKALLYFIHVMDHIVVKEYVLVYFHTLTSDYNRLDSD
FLKKLYDVVDAKYKRNLKAVYFVHPTFRSKV
Download sequence
Identical sequences F7A761
ENSOANP00000004859 9258.ENSOANP00000004859 ENSOANP00000004859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]