SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000004911 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000004911
Domain Number 1 Region: 256-324
Classification Level Classification E-value
Superfamily Homeodomain-like 3.85e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 47-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000615
Family LIM domain 0.0076
Further Details:      
 
Domain Number 3 Region: 78-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000079
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000004911   Gene: ENSOANG00000003099   Transcript: ENSOANT00000004912
Sequence length 407
Comment pep:novel ultracontig:OANA5:Ultra134:446827:467700:1 gene:ENSOANG00000003099 transcript:ENSOANT00000004912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEGPAISSAIDRGETETTMPSISSERAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRYRSPNEAAKAPS
NVSAPSPCLCLLLRLTQWLCFSPSLMLTVSPSPGSRFRRVSPALGLTGLQGGGPPSPERG
PSPAGCVRVSVREMEDGAGGGCSQPGGVCVCVWGGVVVVSKLKERWGRKKNPGDGGDLAA
YNAALSCNENDGDHLDRDQQYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDSTLQTGTPSGPASEISNASMS
PSSTPTTLTDLTNPTMPTVTSVLTSVPGSLEGHESRSPSQTTLTNLF
Download sequence
Identical sequences F6VYH0
ENSOANP00000004911 ENSOANP00000004911 9258.ENSOANP00000004911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]