SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007348 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007348
Domain Number 1 Region: 327-460,766-941
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 59-181
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-30
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 1146-1211
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-19
Family SAM (sterile alpha motif) domain 0.0034
Further Details:      
 
Domain Number 4 Region: 227-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.06e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000366
Further Details:      
 
Domain Number 5 Region: 167-223
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007348   Gene: ENSOANG00000004633   Transcript: ENSOANT00000007350
Sequence length 1220
Comment pep:known_by_projection chromosome:OANA5:20:792910:939305:1 gene:ENSOANG00000004633 transcript:ENSOANT00000007350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPSLMSRPGPVSSQESERMAGAAGPGDESSDSEAEHEGPQKLIRKVSTSGQIRSKTS
VKEGILLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAESSTKNVNNS
FTIITPFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMHNWYACSHARP
TFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGIAM
PHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKAMVHTACKDLYPRKCPLGQCKVS
IIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDL
MNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLSLHKQCQLGVLPLGTGNDLAR
VLGWGGSCDDDTQLPQILEKLERASTKMLDRWSIMSYELKLPTKASILPATPEEESESVF
QMSSYEDSVAAHLAKILNSDQHSVVISSAKVLCETVKDFVAKIGKTYEKPVENTDEADAM
SVKCSVLNEKLDQLLQALHAEAQASPAPPTISPPIVEEEPGDFSSEDSSLTDSKEQPLEG
ITKSSTQKIFKPRELMLRANSLKKAVRQIIEQAEKVVDEQNSHTEDQGIQSPPIDDSKEA
DEFKEDDKDDDAKECLSAKTAPRSPDRRTSGVFSQPSSVSGPVTAANKENLPVLNTRIIC
PGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDPDSLEGYSEKCVMNNYFGIGLDA
KISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKVQLECDGQYIPLPS
LQGIAVLNIPSYAGGTNFWGGTKEDDIFGAPSFDDKILEVVAVFGSMQMAVSRVIKLQHH
RIAQCRSVKITILGDEGVPVQVDGEAWIQPPGIIKIVHKNRAQMLTRDRAFENTLKSWED
KQKYDTCKPALRPHLYPQQAVDLATEEEVSQMQLCSQAAEELITRICEAAKIHSLLEQEL
AHAVNACSHAMNKANPRFPESLTRNTAIEIAVNVKALHNETESLLVGRVPLQLESPHEEL
VSTALHSVEVELQKLTEIPWLYYVLQPNDDEDPPLEYVKRNNRSTVFRIVPKFKKEKVQK
HKSSPQPVQKWGTDEVAAWLDLLSLGEYKETFIRHDIRGAELLHLERRDLKDLGITKVGH
MKRILQGIKELGKGTPLAEV
Download sequence
Identical sequences F7FVB6
ENSOANP00000007348 ENSOANP00000007348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]