SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008133 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008133
Domain Number 1 Region: 296-370
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000155
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 
Domain Number 2 Region: 95-171
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000196
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 
Domain Number 3 Region: 930-1016
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000471
Family Carboxypeptidase regulatory domain 0.028
Further Details:      
 
Domain Number 4 Region: 849-920
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000569
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000008133
Domain Number - Region: 181-266
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00275
Family Rhamnogalacturonase B, RhgB, middle domain 0.032
Further Details:      
 
Domain Number - Region: 776-834
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0145
Family Cna protein B-type domain 0.01
Further Details:      
 
Domain Number - Region: 24-82
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0471
Family Cna protein B-type domain 0.01
Further Details:      
 
Domain Number - Region: 469-529
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0575
Family Hypothetical protein PA1324 0.015
Further Details:      
 
Domain Number - Region: 511-552
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0804
Family Rhamnogalacturonase B, RhgB, middle domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008133   Gene: ENSOANG00000005122   Transcript: ENSOANT00000008135
Sequence length 1188
Comment pep:novel ultracontig:OANA5:Ultra102:1131671:1175151:1 gene:ENSOANG00000005122 transcript:ENSOANT00000008135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHCATQGTVSANSVVLYSALHIIKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIE
PPLGWSFEPTSVDLHVDGVNDICTKGGDINFVFTGFSVNGKVLSKGQVLGPAGVRVALRN
VGNEANMQSTVTQPGGKFAFFKVLPGEYEIFASHPTWAMKEASTTVRVTNSNAYAASPLV
VAGYNVSGFVRSDGEPMKGVTFLLFSSSVTKEDILGCNISPVDGFQPQDEKLFYLCSVIS
KEDGSFSFFSLPSGGYTVIPFYRGERITFDVAPARLDFTVEHDSLKIEPVFRVMGFSVTG
RVLNGPEGEGVVDAIVTLNSQIQVKTKADGSFRLENITTGTYTIQAQKEHLYFDTITVKI
APNTPQLADIVATGFSVCGHISITRFPDTIKQIGRYRITMSPQDKDRSLTAVETDTHGAF
CFKARAGSYIIQVVVPEAEIRAGLALKPKMFPITVVDRPVMDVIFSQFLASVSGKVSCLD
TCGDLVVTLQSLSRQGEKRSLQLSGKTDSVTFTFDNVLPGKYKISIIHEDWCWRNKSLEV
EVTEDDASGIEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGV
YKVTPRSCHRFEHGYYTYDTSSPSILTLTAIRHHVLGTITTDKLLDVTVTIKSSIDSEPA
LVLGPLKSLQEMRREQQLAEIKTRRQEREKNGKGEGGGGTKPPVQEMVDELQGPFLYDFS
YWARSGEKITVTPSSKELLFYPPSVETVVSGETCPGKLIEIQGKAGLFLEGQIHPELEGV
EIVISEKGAPSPLITVFTDDRGTYSVGPLHSDLEYTVTSQKEGFVLTAVEGTIGDFKAFA
LAGVTFEIKAEDDQPLAGVLLSLSGGVFRSNLLTQDNGRLTFSNLSPGQYYFKPMMKEFR
FEPSSQMIEVQEGQNLKITITGHRTAYSCYGTISSLNGEPEQGVSVEAVGQNDCGIYGED
TVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPQHRVIEVGNSDIDDVNIIAFRQI
NQFDLSGNVITSSEHLPSLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLL
DSTLSKSQYDYTLPQVSFTATGYHKHVTLIFNPTRKLPEQDIAQGSYIALPLTLLLLLAG
YNHDKLIPLLLQLTSRLQGVRALGQAGSDVGGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences F6XCA6
9258.ENSOANP00000008133 ENSOANP00000008133 ENSOANP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]