SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009124 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009124
Domain Number 1 Region: 150-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 120-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000242
Family EGF-type module 0.03
Further Details:      
 
Domain Number 3 Region: 69-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000009124
Domain Number - Region: 47-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0166
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 196-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0522
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009124   Gene: ENSOANG00000005731   Transcript: ENSOANT00000009126
Sequence length 357
Comment pep:known ultracontig:OANA5:Ultra378:6305728:6320698:1 gene:ENSOANG00000005731 transcript:ENSOANT00000009126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LINSLSGIACKPGCHPTNGFCANPNECRCQPGWRGPLCTECIPFPGCLHGGCTLPWQCVC
QEGWVGSLCDIDTHPCSATPCTNNSTCIETGDGGYVCLCGPGFTGKNCHLRKGPCIINGS
PCQNGGACVDGDGSAPHASCLCPSGFTGHFCELDADDCHPNPCAHGGACTDIGRDFRCHC
PTGFTGKSCGRRLPACLDSVGGPRLECVCPHGLSGPTCAHFGHNSTGPSRSLERGEGPGD
PPAQEALRGASGHHQERRVLKISLKEVIRHADPWLSHSQVTCLIVLGLLTCLVVLGTTAI
VFYSKCETWLANAKYSRLLRKKKRRLMTSNNGETLSVNIIFPEKVKLTSYSTCSAAM
Download sequence
Identical sequences F6X0Y0
ENSOANP00000009124 ENSOANP00000009124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]